Catalogue Search | MBRL
Are you sure you want to remove the book from the shelf?
{{itemTitle}}
18,667
result(s) for
"Johnson, John A."
Sort by:
Something borrowed
Rachel is a generous and loyal pal to her engaged best friend Darcy. But after celebrating her 30th birthday, perpetual good girl Rachel unexpectedly ends up in the arms of Dex, the guy she's had a crush on since law school, and who happens to be Darcy's fiancé. In the frantic weeks leading up to Darcy's wedding, Rachel finds herself caught between her longtime friendship with Darcy and the prospect of losing the love of her life.
DVD
Assessing the structure of the Five Factor Model of Personality (IPIP-NEO-120) in the public domain
Assessment of individual differences in personality traits is arguably one of the hallmarks of psychological research. Testing the structural validity of trait measurements is paramount in this endeavor. In the current study, we investigated 30 facet traits in one of the accessible and comprehensive public-domain Five Factor Model (FFM) personality inventories, IPIP-NEO-120 (Johnson, 2014), using one of the largest US samples to date ( N = 320,128). We present structural loadings for all trait facets organized into respective FFM-trait domain (Neuroticism, Extraversion, Openness, Agreeableness, and Conscientiousness). Both hierarchical second-order and bi-factor models showed tolerable model fit indices, using confirmatory factor analysis in a structural equation modeling (SEM) framework. Some facet traits were substantially more representative than others for their respective trait domain, which facilitate further discussions on FFM-construct content. We conclude that IPIP-NEO is sufficiently structurally robust for future use, for the benefit of research and practice in personality assessment.
Journal Article
Correcting a Longstanding Misconception about Social Roles and Personality: A Case Study in the Psychology of Science
Psychologists often argue that sex roles direct different types of socializing behaviors toward males and females and that this differential treatment, in turn, leads to sex differences in personality. Widely cited in support of this thesis has been the Fels longitudinal study finding that dependency and passivity are stable from childhood to adulthood for females only and aggressiveness and sexuality for males only. The present article explains why the type of sex differences in personality stability cited by Fels researchers actually contradicts the view that sex role expectations cause these differences. The report suggests ways in which social learning theory, the dominant developmental paradigm of the 1960s, may have contributed to the misinterpretation of the Fels data and how the rise of social constructivism maintained this misinterpretation for decades. The article concludes by correcting misconceptions about biology and personality stability and by explaining why theories that incorporate biology are not only more adequate than social constructivism but also more effective in bringing about the changes in society that constructivists desire.
Journal Article
Electrophysiological ventricular substrate of stroke: a prospective cohort study in the Atherosclerosis Risk in Communities (ARIC) study
ObjectivesThe goal of the study was to determine an association of cardiac ventricular substrate with thrombotic stroke (TS), cardioembolic stroke (ES) and intracerebral haemorrhage (ICH).DesignProspective cohort study.SettingThe Atherosclerosis Risk in Communities (ARIC) study in 1987–1989 enrolled adults (45–64 years), selected as a probability sample from four US communities (Minneapolis, Minnesota; Washington, Maryland; Forsyth, North Carolina; Jackson, Mississippi). Visit 2 was in 1990–1992, visit 3 in 1993–1995, visit 4 in 1996–1998 and visit 5 in 2011–2013.ParticipantsARIC participants with analysable ECGs and no history of stroke were included (n=14 479; age 54±6 y; 55% female; 24% black). Ventricular substrate was characterised by cardiac memory, spatial QRS-T angle (QRS-Ta), sum absolute QRST integral (SAIQRST), spatial ventricular gradient magnitude (SVGmag), premature ventricular contractions (PVCs) and tachycardia-dependent intermittent bundle branch block (TD-IBBB) on 12-lead ECG at visits 1–5.OutcomeAdjudicated TS included a first definite or probable thrombotic cerebral infarction, ES—a first definite or probable non-carotid cardioembolic brain infarction. Definite ICH was included if it was the only stroke event.ResultsOver a median 24.5 years follow-up, there were 899 TS, 400 ES and 120 ICH events. Cox proportional hazard risk models were adjusted for demographics, cardiovascular disease, risk factors, atrial fibrillation, atrial substrate and left ventricular hypertrophy. After adjustment, PVCs (HR 1.72; 95% CI 1.02 to 2.92), QRS-Ta (HR 1.15; 95% CI 1.03 to 1.28), SAIQRST (HR 1.20; 95% CI 1.07 to 1.34) and time-updated SVGmag (HR 1.19; 95% CI 1.08 to 1.32) associated with ES. Similarly, PVCs (HR 1.53; 95% CI 1.03 to 2.26), QRS-Ta (HR 1.08; 95% CI 1.01 to 1.16), SAIQRST (HR 1.07; 95% CI 1.01 to 1.14) and time-updated SVGmag (HR 1.11; 95% CI 1.04 to 1.19) associated with TS. TD-IBBB (HR 3.28; 95% CI 1.03 to 10.46) and time-updated SVGmag (HR 1.23; 95% CI 1.03 to 1.47) were associated with ICH.ConclusionsPVC burden (reflected by cardiac memory) is associated with ischaemic stroke. Transient cardiac memory (likely through TD-IBBB) precedes ICH.
Journal Article
An Inhibitor of the δPKC Interaction with the d Subunit of F1Fo ATP Synthase Reduces Cardiac Troponin I Release from Ischemic Rat Hearts: Utility of a Novel Ammonium Sulfate Precipitation Technique
We have previously reported protection against hypoxic injury by a cell-permeable, mitochondrially-targeted δPKC-d subunit of F1Fo ATPase (dF1Fo) interaction inhibitor [NH2-YGRKKRRQRRRMLA TRALSLIGKRAISTSVCAGRKLALKTIDWVSFDYKDDDDK-COOH] in neonatal cardiac myo-cytes. In the present work we demonstrate the partitioning of this peptide to the inner membrane and matrix of mitochondria when it is perfused into isolated rat hearts. We also used ammonium sulfate ((NH4)2SO4) and chloroform/methanol precipitation of heart effluents to demonstrate reduced card-iac troponin I (cTnI) release from ischemic rat hearts perfused with this inhibitor. 50% (NH4)2SO4 saturation of perfusates collected from Langendorff rat heart preparations optimally precipitated cTnI, allowing its detection in Western blots. In hearts receiving 20 min of ischemia followed by 30, or 60 min of reperfusion, the Mean±S.E. (n=5) percentage of maximal cTnI release was 30 ± 7 and 60 ± 17, respectively, with additional cTnI release occurring after 150 min of reperfusion. Perfusion of hearts with the δPKC-dF1Fo interaction inhibitor, prior to 20 min of ischemia and 60-150 min of reperfusion, reduced cTnI release by 80%. Additionally, we found that when soybean trypsin inhibitor (SBTI), was added to rat heart effluents, it could also be precipitated using (NH4)2SO4 and detected in western blots. This provided a convenient method for normalizing protein recoveries between groups. Our results support the further development of the δPKC-dF1Fo inhibitor as a potential therapeutic for combating cardiac ischemic injury. In addition, we have developed an improved method for the detection of cTnI release from perfused rat hearts.
Journal Article
Taekwondo as an Academic Field of Study for Non-Koreans: An Unconventional and Extreme Form of Martial Arts Tourism
Many Korean universities grant undergraduate and graduate school degrees in part on coursework, theses, and dissertations that explore Taekwondo through various academic lenses in Taekwondo Studies programs, yet only a few individuals have traveled to the Korean Peninsula to study Taekwondo academically. Traveling internationally to earn a university degree in a martial art can be considered extreme martial arts tourism. This multidisciplinary study explores the motivations of non-Koreans who have studied Taekwondo academically in Korea as well as their aspirations after graduation. The study utilized a combination of autoethnographic techniques and interviews with individuals who have given up years of their lives, thousands of dollars, their home cultures, languages, and food, and their families to travel to a foreign university in order to study Taekwondo. Twelve participants were identified that met the selection criteria, but eight responded to the interview requests. The nine participants, including the author, came from a wide assortment of backgrounds, but all shared a passion for Taekwondo; now, most participants (n = 5) have jobs within the Taekwondo industry, including two professors in separate Departments of Taekwondo. This study’s findings elucidate why non-Koreans study Taekwondo academically and thereby offer suggestions on how to improve this educational market.
Journal Article
Transit Analysis Package : An IDL Graphical User Interface for Exoplanet Transit Photometry
We present an IDL graphical user-interface-driven software package designed for the analysis of exoplanet transit light curves. The Transit Analysis Package (TAP) software uses Markov Chain Monte Carlo (MCMC) techniques to fit light curves using the analytic model of Mandal and Agol (2002). The package incorporates a wavelet-based likelihood function developed by Carter and Winn (2009), which allows the MCMC to assess parameter uncertainties more robustly than classic χ2 methods by parameterizing uncorrelated “white” and correlated “red” noise. The software is able to simultaneously analyze multiple transits observed in different conditions (instrument, filter, weather, etc.). The graphical interface allows for the simple execution and interpretation of Bayesian MCMC analysis tailored to a user’s specific data set and has been thoroughly tested on ground-based and Kepler photometry. This paper describes the software release and provides applications to new and existing data. Reanalysis of ground-based observations of TrES-1b, WASP-4b, and WASP-10b (Winn et al., 2007, 2009; Johnson et al., 2009; resp.) and space-based Kepler 4b–8b (Kipping and Bakos 2010) show good agreement between TAP and those publications. We also present new multi-filter light curves of WASP-10b and we find excellent agreement with previously published values for a smaller radius.
Journal Article
Build a Culture of Peace, not a Culture of Winning, through Taekwondo Diplomacy
South and North Korea have utilized Taekwondo1 demonstrations for soft diplomacy purposes for decades. Yet, there has been little discussion on the potential complications with using Taekwondo for diplomatic purposes. Despite their good intentions, the current Taekwondo governing bodies’ proposals to hold competitions between their athletes ignores previous sport diplomacy theory, the organizations’ successes, and hazards outlined in current sports diplomacy research. Moreover, there exists a possibly of increasing hostilities between the Korean peoples and possibly not influencing the target audience. This exploratory study discusses the complications currently existent in this strategy and offers a potential solution that focuses on Taekwondo’s ultimate pedagogical goal: the building of peace. Sport diplomacy and peacebuilding both bring people together to create lasting relationships based on shared interests and values. The present study builds upon recent Taekwondo diplomacy research by suggesting Taekwondo actors adapt Galtung’s (1973) conflict resolution theory (CRT) to avoid the pitfalls of sports diplomacy while building upon the successes of past Taekwondo cultural diplomacy efforts. CRT provides a framework in which Taekwondo can be practiced differently by South and North Korea with respect for the differences between their two peoples and cultures. It is suggested Taekwondo organizations adapt CRT from a practical peacebuilding concept to a theoretical framework for Taekwondo diplomacy to build upon their cultural diplomacy successes. As such, the present research intends to contribute to the broader debate on potential hazards that may harm inter-Korean relations.
Journal Article
State of the Field: Extreme Precision Radial Velocities
The Second Workshop on Extreme Precision Radial Velocities defined circa 2015 the state of the art Doppler precision and identified the critical path challenges for reaching 10 cm s(-1) measurement precision. The presentations and discussion of key issues for instrumentation and data analysis and the workshop recommendations for achieving this bold precision are summarized here. Beginning with the High Accuracy Radial Velocity Planet Searcher spectrograph, technological advances for precision radial velocity (RV) measurements have focused on building extremely stable instruments. To reach still higher precision, future spectrometers will need to improve upon the state of the art, producing even higher fidelity spectra. This should be possible with improved environmental control, greater stability in the illumination of the spectrometer optics, better detectors, more precise wavelength calibration, and broader bandwidth spectra. Key data analysis challenges for the precision RV community include distinguishing center of mass (COM) Keplerian motion from photospheric velocities (time correlated noise) and the proper treatment of telluric contamination. Success here is coupled to the instrument design, but also requires the implementation of robust statistical and modeling techniques. COM velocities produce Doppler shifts that affect every line identically, while photospheric velocities produce line profile asymmetries with wavelength and temporal dependencies that are different from Keplerian signals. Exoplanets are an important subfield of astronomy and there has been an impressive rate of discovery over the past two decades. However, higher precision RV measurements are required to serve as a discovery technique for potentially habitable worlds, to confirm and characterize detections from transit missions, and to provide mass measurements for other space-based missions. The future of exoplanet science has very different trajectories depending on the precision that can ultimately be achieved with Doppler measurements.
Journal Article
Evidence of Inverse Hall-Petch Behavior and Low Friction and Wear in High Entropy Alloys
We present evidence of inverse Hall-Petch behavior for a single-phase high entropy alloy (CoCrFeMnNi) in ultra-high vacuum and show that it is associated with low friction coefficients (~0.3). Grain size measurements by STEM validate a recently proposed dynamic amorphization model that accurately predicts grain size-dependent shear strength in the inverse Hall-Petch regime. Wear rates in the initially soft (coarse grained) material were shown to be remarkably low (~10
–6
mm
3
/N-m), the lowest for any HEA tested in an inert environment where oxidation and the formation of mixed metal-oxide films is mitigated. The combined high wear resistance and low friction are linked to the formation of an ultra-nanocrystalline near-surface layer. The dynamic amorphization model was also used to predict an average high angle grain boundary energy (0.87 J/m
2
). This value was used to explain cavitation-induced nanoporosity found in the highly deformed surface layer, a phenomenon that has been linked to superplasticity.
Journal Article